Loading...
Statistics
Advertisement

交友邀请
www.j-style.org/

J-style.org

Advertisement
Conversion Technology Metas Server
J-style.org is hosted in Korea, Republic of . J-style.org doesn't use HTTPS protocol. Number of used technologies: 2. First technologies: Html, Javascript, Number of used javascripts: 5. First javascripts: Share.js, PerShow.js, Sip.js, Number of used analytics tools: 0. Its server type is: nginx.

Technologies in use by J-style.org

Technology

Number of occurences: 2
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 5
  • share.js
  • perShow.js
  • sip.js
  • jquery.min.js
  • percentage.js

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - J-style.org

Missing HTTPS protocol.

    Meta - J-style.org

    Number of occurences: 3
    • Name:
      Content:
    • Name: viewport
      Content: width=device-width,initial-scale=1.0,maximum-scale=1.0,user-scalable=no
    • Name: format-detection
      Content: telephone=no

    Server / Hosting

    • IP: 112.175.234.213
    • Latitude: 37.51
    • Longitude: 126.97
    • Country: Korea, Republic of

    Rname

    • f1g1ns1.dnspod.net
    • f1g1ns2.dnspod.net

    Target

    • freednsadmin.dnspod.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx Date: Fri, 22 Jul 2016 08:05:01 GMT Content-Type: text/html Content-Length: 4340 Last-Modified: Thu, 30 Jun 2016 02:58:16 GMT ETag: "57748ac8-10f4" Accept-Ranges: bytes X-Cache: MISS from s_fl413 X-Cache-Lookup: MISS from s_fl413:80 Via: 1.1 s_fl413 (squid/3.5.19) Connection: keep-alive

    DNS

    host: j-style.org
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: f1g1ns1.dnspod.net
    host: j-style.org
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: f1g1ns2.dnspod.net
    host: j-style.org
    1. class: IN
    2. ttl: 600
    3. type: SOA
    4. mname: f1g1ns1.dnspod.net
    5. rname: freednsadmin.dnspod.com
    6. serial: 1451803456
    7. refresh: 3600
    8. retry: 180
    9. expire: 1209600
    10. minimum-ttl: 180

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.-style.org, www.jz-style.org, www.z-style.org, www.jh-style.org, www.h-style.org, www.jn-style.org, www.n-style.org, www.j.-style.org, www..-style.org, www.ju-style.org, www.u-style.org, www.jk-style.org, www.k-style.org, www.jl-style.org, www.l-style.org, www.jo-style.org, www.o-style.org, www.jstyle.org, www.j-tstyle.org, www.jtstyle.org, www.j-gstyle.org, www.jgstyle.org, www.j-hstyle.org, www.jhstyle.org, www.j-ustyle.org, www.justyle.org, www.j-jstyle.org, www.jjstyle.org, www.j-xstyle.org, www.jxstyle.org, www.j-sstyle.org, www.jsstyle.org, www.j-astyle.org, www.jastyle.org, www.j-style.org, www.jstyle.org, www.j- style.org, www.j style.org, www.j-tyle.org, www.j-setyle.org, www.j-etyle.org, www.j-swtyle.org, www.j-wtyle.org, www.j-sdtyle.org, www.j-dtyle.org, www.j-sxtyle.org, www.j-xtyle.org, www.j-sftyle.org, www.j-ftyle.org, www.j-sgtyle.org, www.j-gtyle.org, www.j-sttyle.org, www.j-ttyle.org, www.j-syle.org, www.j-stqyle.org, www.j-sqyle.org, www.j-stayle.org, www.j-sayle.org, www.j-st yle.org, www.j-s yle.org, www.j-stwyle.org, www.j-swyle.org, www.j-steyle.org, www.j-seyle.org, www.j-stzyle.org, www.j-szyle.org, www.j-stxyle.org, www.j-sxyle.org, www.j-stcyle.org, www.j-scyle.org, www.j-stle.org, www.j-styzle.org, www.j-stzle.org, www.j-styale.org, www.j-stale.org, www.j-stysle.org, www.j-stsle.org, www.j-stydle.org, www.j-stdle.org, www.j-style.org, www.j-stle.org, www.j-stycle.org, www.j-stcle.org, www.j-sty le.org, www.j-st le.org, www.j-stye.org, www.j-stylue.org, www.j-styue.org, www.j-styl8e.org, www.j-sty8e.org, www.j-styl9e.org, www.j-sty9e.org, www.j-stylje.org, www.j-styje.org, www.j-styl0e.org, www.j-sty0e.org, www.j-stylme.org, www.j-styme.org, www.j-stylpe.org, www.j-stype.org, www.j-styloe.org, www.j-styoe.org, www.j-styl.org, www.j-stylex.org, www.j-stylx.org, www.j-styles.org, www.j-styls.org, www.j-stylew.org, www.j-stylw.org, www.j-styler.org, www.j-stylr.org, www.j-stylef.org, www.j-stylf.org, www.j-stylev.org, www.j-stylv.org, www.j-stylec.org, www.j-stylc.org, www.j-styleq.org, www.j-stylq.org, www.j-stylea.org, www.j-styla.org, www.j-styley.org, www.j-styly.org,

    Other websites we recently analyzed

    1. SkinRash.net
      United Kingdom - 176.74.176.186
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    2. Благоустройство могил.Уборка могил Алматы.
      Агентство по уходу за местами захоронений.Благоустройство могил.Уборка могил.
      Ashburn (United States) - 52.6.217.246
      Server software: Pepyaka/1.11.3
      Technology: CSS, Html, Html5, Javascript, Wix
      Number of Javascript: 2
      Number of meta tags: 7
    3. Home — Lca
      La Associazione Rete Italiana LCA si pone come punto di riferimento in Italia per i principali operatori in materia di Life Cycle Assessment (LCA), favorendo sia la diffusione della metodologia a livello nazionale, sia lo scambio di esperienze applicative tese a sostenere l’approccio del ciclo di vita. Mira a consolidare e armonizzare gli strumenti di valutazione per lo sviluppo sostenibile e ad organizzare e realizzare attività a livello nazionale e internazionale di formazione, informazione, documentazione e divulgazione scientifica. L’Associazione, inoltre, si pone l’obiettivo di esercitare azioni d’indirizzo presso gli organi istituzionali, tese a sostenere l’approccio del ciclo di vita e la LCA.
      Italy - 192.107.92.74
      Server software: squid/3.5.12
      Technology: CloudFlare, CSS, Html, Html5, Javascript
      Number of Javascript: 5
      Number of meta tags: 4
    4. seekandyeeshallfind.com
      Scottsdale (United States) - 184.168.221.55
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    5. wesell-lv.com | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
      Cyprus - 93.89.226.17
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html
    6. Campement Kunja - Paradijsje in Zuid-Senegal
      Netherlands - 188.93.150.48
      Server software: Apache/2.4.10
      Technology: Html
    7. edirneevdenevenakliyatfirmalari.com | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
      Cyprus - 93.89.226.17
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html
    8. uda.wang
      Chai Wan (Hong Kong) - 103.51.144.89
      Server software: Tengine/1.4.2
      Technology: Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    9. Дмитрий Чубаров
      San Francisco (United States) - 208.93.0.150
      Server software: squid/3.5.14
      Technology: AdFox, DoubleClick.Net, CSS, Html, Html5, Iframe, Javascript, Php, SVG, Yandex.Metrika, comScore, Google Analytics, Google Tagmanager
      Number of Javascript: 5
      Number of meta tags: 2
    10. KillerLabs
      Brea (United States) - 69.163.186.251
      Server software: Apache
      Technology: CSS, Html

    Check Other Websites